SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038236 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038236
Domain Number 1 Region: 17-107
Classification Level Classification E-value
Superfamily Immunoglobulin 1.62e-23
Family V set domains (antibody variable domain-like) 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038236   Gene: ENSMODG00000025460   Transcript: ENSMODT00000039836
Sequence length 107
Comment pep:novel chromosome:BROADO5:8:205031589:205042684:1 gene:ENSMODG00000025460 transcript:ENSMODT00000039836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FVTIFLLGTGGQPDAGVTQHPDYLVARKGQSVTLGCDPISGHLSAFWYRQIKHQGPVMLF
NYYNKKLSEKGNISDRFIAEQQNDLHFKLIISSLEQADSALYLCASS
Download sequence
Identical sequences F6RK43
ENSMODP00000038236 13616.ENSMODP00000038236 ENSMODP00000038236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]