SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038238 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038238
Domain Number 1 Region: 32-123
Classification Level Classification E-value
Superfamily Immunoglobulin 2.36e-22
Family V set domains (antibody variable domain-like) 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038238   Gene: ENSMODG00000025462   Transcript: ENSMODT00000039838
Sequence length 126
Comment pep:novel chromosome:BROADO5:8:205132244:205132824:1 gene:ENSMODG00000025462 transcript:ENSMODT00000039838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIHAWLVPHMGIKFLHCISIFLLGAGLTDAEVTQTPKQLVTEIRQQVNLTCHPISGHTGL
YWYQQVTGNGIELLVYLQNNKILDDTQFSKDRFSVIWPKSSPSILTIKTTELKDSAVYLC
ASSPTT
Download sequence
Identical sequences F6RK26
ENSMODP00000038238 ENSMODP00000038238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]