SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038240 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038240
Domain Number 1 Region: 20-112
Classification Level Classification E-value
Superfamily Immunoglobulin 1.45e-22
Family V set domains (antibody variable domain-like) 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038240   Gene: ENSMODG00000025463   Transcript: ENSMODT00000039840
Sequence length 116
Comment pep:novel chromosome:BROADO5:8:205150548:205158457:1 gene:ENSMODG00000025463 transcript:ENSMODT00000039840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFLHWISIFLLGAGLTDAGVTQVPKYLITETGQQVTLTCGPISGHVALYWYQQITGKGIE
MLVNFQNNKALDDTRLPKERFIVEWLKESPSTLTIKSTEFGDSAVYLCASSSTTAL
Download sequence
Identical sequences F6RJM4
ENSMODP00000038240 ENSMODP00000038240 13616.ENSMODP00000038240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]