SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038241 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038241
Domain Number 1 Region: 34-93
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000743
Family V set domains (antibody variable domain-like) 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038241   Gene: ENSMODG00000025464   Transcript: ENSMODT00000039841
Sequence length 93
Comment pep:novel chromosome:BROADO5:8:205169092:205169407:1 gene:ENSMODG00000025464 transcript:ENSMODT00000039841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIDTGVTQLLKQFITETRQAVILTGNPILGHILYSQMTRKGIEQLLYLQSNKAFDVTELP
KDQFLVKWPKTSPSTLRIQHTELGDSAVYLCAS
Download sequence
Identical sequences F6RJL4
13616.ENSMODP00000038241 ENSMODP00000038241 ENSMODP00000038241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]