SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038379 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038379
Domain Number 1 Region: 113-206
Classification Level Classification E-value
Superfamily Immunoglobulin 4.65e-20
Family I set domains 0.002
Further Details:      
 
Domain Number 2 Region: 18-111
Classification Level Classification E-value
Superfamily Immunoglobulin 1.22e-19
Family I set domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038379   Gene: ENSMODG00000025580   Transcript: ENSMODT00000039979
Sequence length 262
Comment pep:novel chromosome:BROADO5:4:406351562:406354304:-1 gene:ENSMODG00000025580 transcript:ENSMODT00000039979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGLCLQERAQAQEGTFLRPSLRAEPSSVVPQGTPVRLWCRGSPTAHLFTLRKAGPGGYAD
IYVVIPPAVGMEAEFLLSSVTASDGGLYKCCYRSPSGGSEDSEPLQLAVTGYYNRPRLSA
EPSQDVAWGHNVTLRCLSVQGIDRFVLYRVEGANSSPWRDPQSHPDFLIRAVAAPHEGNY
SCYEFHSQHPYAWSLPSAPLELRVTGEDSWSPGALREGAQNATSQDYTKGNLIRLSLAGL
ILLILGVLLADAWHTGRRYQGA
Download sequence
Identical sequences F6U2K3
ENSMODP00000038379 ENSMODP00000038379 13616.ENSMODP00000038379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]