SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038381 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038381
Domain Number 1 Region: 215-310
Classification Level Classification E-value
Superfamily Immunoglobulin 1.4e-21
Family I set domains 0.0034
Further Details:      
 
Domain Number 2 Region: 116-214
Classification Level Classification E-value
Superfamily Immunoglobulin 3e-21
Family I set domains 0.0039
Further Details:      
 
Domain Number 3 Region: 16-114
Classification Level Classification E-value
Superfamily Immunoglobulin 8.69e-20
Family I set domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038381   Gene: ENSMODG00000025582   Transcript: ENSMODT00000039981
Sequence length 311
Comment pep:novel chromosome:BROADO5:4:406594957:406663702:-1 gene:ENSMODG00000025582 transcript:ENSMODT00000039981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAPLYFPAIFLLGLLPKPTLWAQPALVVAPGTNITLWCSRPRLSSVKEWRFTLWKVEKH
HPLQKHFSAESQTGFLLSSVSPEDTGSYSCTYMEPNSSDGISMMSDALELLVPGLLPKPT
LWAQPAPVVAPRTSITLWCSRPKLSSVLKWRFTLWKDGMHHPLQKHLSAESQTGFLLSSV
SPEDTGSYKCTYMEPNSSNGISKMSDALELVVTDVFPKASLSVWPGPEVASGTNVTLLCK
GPSWSTKFLLHKEGDDEILHSTDIIQDGAQFFFPHVTTKHSGIYTCSYKPSTNGSLWTQQ
SDPLEVTVRGE
Download sequence
Identical sequences F6U2I7
ENSMODP00000038381 ENSMODP00000038381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]