SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038382 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038382
Domain Number 1 Region: 26-119
Classification Level Classification E-value
Superfamily Immunoglobulin 3.64e-22
Family I set domains 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038382   Gene: ENSMODG00000025583   Transcript: ENSMODT00000039982
Sequence length 119
Comment pep:novel chromosome:BROADO5:4:408703419:408704233:1 gene:ENSMODG00000025583 transcript:ENSMODT00000039982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPILCALLSLGLCLGQRMTQAPDRLPRPSLREENGSLVPEGRNVTLSCRGSWEADLYRL
EKKQGSKWLRIMDETAAESKGKFFLSSVTWSHAGTYYCRYRHSSLWSESSDALKLVVTG
Download sequence
Identical sequences F6U2H5
ENSMODP00000038382 ENSMODP00000038382 13616.ENSMODP00000038382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]