SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038402 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038402
Domain Number 1 Region: 18-112
Classification Level Classification E-value
Superfamily Immunoglobulin 4.56e-20
Family I set domains 0.00076
Further Details:      
 
Domain Number 2 Region: 115-210
Classification Level Classification E-value
Superfamily Immunoglobulin 5.78e-20
Family I set domains 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038402   Gene: ENSMODG00000025595   Transcript: ENSMODT00000040002
Sequence length 429
Comment pep:novel chromosome:BROADO5:4:407968141:407981634:1 gene:ENSMODG00000025595 transcript:ENSMODT00000040002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCLDLALNPPSHSICYRLPRPSLRAENGSLVPQGGAVTLRCRGSWEAEEWRLEKKRRYEW
SEIKPVRQARNEGEFSLPYVTSHDAGTYRCLYRHSSFGWSKRSDPLELVVTGLSAPPSLT
ALPSSEVASGQSVTLQCRSERWYDWCVLCKEGEEIRRGGTRRHGWMYQTDFFFPGVTSTQ
EGTYRCYGFDSSSPSVWSSPSAPLLLWLSGEAAPAPPRPSQPLPNSPPPETFSTSPESEN
KPSGLSILQVSILVGISAFLILIFLFLSLLYFHHCRYQPRLGKRDREADIKTTRRGPQKT
PHFSYNTPVYSPFSDPPPQFSVSSSSPAQNKQGAPRRLCVSDREVGQEGKACPGESHLPG
PSSLLLLSPDAAVNDVRQTEEAGQEDTSALQREDPQEVTYAQLDHKRLKRGAEPPPQSGP
VEPSVYAAL
Download sequence
Identical sequences F6QW47
ENSMODP00000038402 ENSMODP00000038402 13616.ENSMODP00000038402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]