SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038502 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038502
Domain Number 1 Region: 24-128
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000034
Family V set domains (antibody variable domain-like) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038502   Gene: ENSMODG00000025674   Transcript: ENSMODT00000040102
Sequence length 203
Comment pep:novel chromosome:BROADO5:2:230327539:230343608:1 gene:ENSMODG00000025674 transcript:ENSMODT00000040102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFQLVILSVFFLILSRTTAKDEVKQFPPLIMAQEGDTINMTCLVSGKLRGLYLRRLTVME
MNVIYSSENEFITALNYKNRTSTSGFLNNLMITIINVQLNDTDVYICQAIMIHENLQGTG
TMVVVTEKKWKQEVGNPKNLQVWVGLIVIFFTIGLALGPLYMMMKKLRKKFHLRRIQNPS
SSIYEDMSHTLRRNTMCPDNQYE
Download sequence
Identical sequences F6U0X7
ENSMODP00000038502 ENSMODP00000038502 XP_007482862.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]