SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038507 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038507
Domain Number 1 Region: 2-108
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 3.25e-33
Family MHC antigen-recognition domain 0.0000748
Further Details:      
 
Domain Number 2 Region: 107-204
Classification Level Classification E-value
Superfamily Immunoglobulin 2.52e-25
Family C1 set domains (antibody constant domain-like) 0.0000267
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038507   Gene: ENSMODG00000025678   Transcript: ENSMODT00000040107
Sequence length 240
Comment pep:novel chromosome:BROADO5:2:268878036:268885486:-1 gene:ENSMODG00000025678 transcript:ENSMODT00000040107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVTVLLMVLDTLTVWSTDIPENYLHQVRSECHMTNGTQRVHFVGRLIYDREEFVRFDSDV
GLFEARTELWKSQVQKWNSQKEIVERARSIVNVCRHNYQFYNKTIVQRKVKPRVKVFPAK
TQPLGHHNLLLCSVTSFYPGEIKVSWFRNAKEEKSGVLSTGQIRNGDWTFQTLVMLEMTP
QRGDVFTCRVDHVSLQSPVFVDWRAQSESAQTKMLIGVGSLVFGMILLGVGLVISLRSSK
Download sequence
Identical sequences F6U0R7
ENSMODP00000038507 ENSMODP00000038507 13616.ENSMODP00000038507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]