SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038573 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038573
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000899
Further Details:      
 
Domain Number 2 Region: 124-169
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000327
Family Spermadhesin, CUB domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038573   Gene: ENSMODG00000025728   Transcript: ENSMODT00000040173
Sequence length 171
Comment pep:novel chromosome:BROADO5:1:84935900:84946170:-1 gene:ENSMODG00000025728 transcript:ENSMODT00000040173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGGSGQCAGRVEVHYQDIWGTVCDDLWDLNEAEVVCRQLGCGQAVSAPGEAYFGPGSGNI
LLDNMQCVGAERYLGQCSHSGWSNHNCGHHEDAGVICSDARNFNSTPPEDGTCSLSPEKG
ESNSCGGVISSLSGSFSSPWYPGNYPTNIQCVWEIHVDKKFHIELMIPNLK
Download sequence
Identical sequences F6T2A0
13616.ENSMODP00000038573 ENSMODP00000038573 ENSMODP00000038573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]