SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038579 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038579
Domain Number 1 Region: 5-65
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000266
Family C1 set domains (antibody constant domain-like) 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000038579
Domain Number - Region: 58-92
Classification Level Classification E-value
Superfamily Dextranase, N-terminal domain 0.00288
Family Dextranase, N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038579   Gene: ENSMODG00000025733   Transcript: ENSMODT00000040179
Sequence length 137
Comment pep:novel chromosome:BROADO5:1:171502288:171508363:1 gene:ENSMODG00000025733 transcript:ENSMODT00000040179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNGTNVACLVKDFYPKTVEIQLHPDNNPSEGVVATADGKFSAVKLGQYKKDLDQINCTV
WHNNKVVKTHFHITSSDTRRKSWYNVKNSRQEDLECYKPTAQIEKVNLLSITLLGFRVLL
AKSIAVNFVLTIKFFLL
Download sequence
Identical sequences F6T251
ENSMODP00000038579 ENSMODP00000038579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]