SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038596 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038596
Domain Number 1 Region: 19-127
Classification Level Classification E-value
Superfamily Immunoglobulin 1.54e-20
Family V set domains (antibody variable domain-like) 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038596   Gene: ENSMODG00000025749   Transcript: ENSMODT00000040196
Sequence length 158
Comment pep:novel chromosome:BROADO5:1:404510316:404546855:-1 gene:ENSMODG00000025749 transcript:ENSMODT00000040196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLTVLLGLSGSQDQEELQVLQPKEPVSVAKGEKVTLNCTVTDSVVSGPVKWFKGAGPQR
KEIYTFQGGSYPRIKAAAPSSNTDFSISISNITPEDTGTYYCVKFKRGYSDTEFKSGGGT
MLSVSGSSLSAQLFVIFLLGLKVLLILNIILFFAYRKK
Download sequence
Identical sequences F6T1Q2
ENSMODP00000038596 13616.ENSMODP00000038596 ENSMODP00000038596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]