SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038626 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038626
Domain Number 1 Region: 20-111
Classification Level Classification E-value
Superfamily Immunoglobulin 1.21e-28
Family V set domains (antibody variable domain-like) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038626   Gene: ENSMODG00000025773   Transcript: ENSMODT00000040226
Sequence length 114
Comment pep:novel chromosome:BROADO5:1:713608017:713611821:1 gene:ENSMODG00000025773 transcript:ENSMODT00000040226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSQLLFRLLMLWVPGSKGEIVLTQSPASVSVSPGERVTISCQASESVKHSDGNTYLNWLQ
QKSGQSPRWLIYQVSKLESGIPARFRLGSGSGTDFTFTISRVEAEDVAHYYSQQ
Download sequence
Identical sequences F7FT18
ENSMODP00000038626 ENSMODP00000038626 13616.ENSMODP00000038626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]