SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038644 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038644
Domain Number 1 Region: 28-135
Classification Level Classification E-value
Superfamily Immunoglobulin 3.49e-19
Family V set domains (antibody variable domain-like) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038644   Gene: ENSMODG00000025787   Transcript: ENSMODT00000040244
Sequence length 140
Comment pep:novel chromosome:BROADO5:1:404452682:404509436:-1 gene:ENSMODG00000025787 transcript:ENSMODT00000040244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSWPYPYSCFLVLTLSLSDSSQGQEEFQVLQTKEPVSVAKGGKVTLNCTILENSPPGPVK
WFKGAGPQRKEIYNFKGGSYPRIKAVVPSSHTDFSISISNITPEDTGTYYCVKFKRGNPD
TEFKSGGGTMLSVSGPKSSI
Download sequence
Identical sequences F7FSQ0
13616.ENSMODP00000038644 ENSMODP00000038644 ENSMODP00000038644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]