SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038664 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038664
Domain Number 1 Region: 90-515
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 9.78e-116
Family Reverse transcriptase 0.0000000124
Further Details:      
 
Domain Number 2 Region: 569-711
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.02e-25
Family Ribonuclease H 0.0038
Further Details:      
 
Domain Number 3 Region: 9-41
Classification Level Classification E-value
Superfamily Acid proteases 0.0000525
Family Retroviral protease (retropepsin) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038664   Gene: ENSMODG00000029316   Transcript: ENSMODT00000041772
Sequence length 824
Comment pep:novel chromosome:BROADO5:Un:82352633:82355129:1 gene:ENSMODG00000029316 transcript:ENSMODT00000041772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSVGPLEVQHSFLLMPDSPLNLLGRDLLCKLRATITCSPDGSLSLEVPEESLKLLPVLL
SENQEAKEPSIFEIPKDIPESLWATSSSDVGLLKSAVPVQIKTKSSPPPSIPQYPLSKEA
IEGITPVINSLIEQGIIIPCKSEYNTPILPIKKPKKGPDGKHIYRFVQDLRAVNNHVIKR
HSVVSNIHTIISSIPSTATYFTVVDLCSAFFSIPIHENSRHIFAFTWKGSQYTWCRLPQG
YVESPSLFEQILSQDTDNITFKNSKLIKYVDDLLLASTDAETCQEDSKHLLLELHKRGHK
ISKDKVQWCLQKVEYLGFILTAGARYISPKRIENIQKLSAPTTKKQLRAILGATGFCRQW
IPCYGEITKPLIALTKDSVPEPLKLEPEHLSALTDLKKAIMSAPALGIPDYNKPFTLYVH
ERRGVASGVLTQTLGPSQRPIAYYSGQLDPVAAGAPPCLRGVAATALLVTKTVDLVLGCP
LTIMCPHEIEALLVKHRTQAFSDQRITRYEITLLNSENITLKRCSTLNPATLLPDLPTSG
EPLHNCETLVSMAEKPRDNLLDTPLDNADLILFPDGSSFMRDGIRYTGAAVVSEFATEWS
ASLPSNISAQGAELIALKQACIIAKDKKATIYTDSRYAFGICHSVGMLWLQRGFLTSAGK
SIANAEIINEVLSALKLPKALAVVHCSAHTGGSDPVSRGNDRADAAAKLAAIEGPGLILT
LTTTDNLNLSLSYNEKEVEKWKQKFKAKQINGVWVSPEGKPLLPRSFYNQICQSIHKNGH
FGTQGIVDSVKRVWIAPGITTVASKVCSACPICQAYNQHAYLGK
Download sequence
Identical sequences K7DYR3
ENSMODP00000038664 ENSMODP00000038664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]