SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038681 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038681
Domain Number 1 Region: 98-220
Classification Level Classification E-value
Superfamily SEA domain 2.48e-33
Family SEA domain 0.0013
Further Details:      
 
Domain Number 2 Region: 1-98
Classification Level Classification E-value
Superfamily SEA domain 1.22e-29
Family SEA domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038681   Gene: ENSMODG00000029402   Transcript: ENSMODT00000041789
Sequence length 229
Comment pep:novel chromosome:BROADO5:Un:84953857:84959886:1 gene:ENSMODG00000029402 transcript:ENSMODT00000041789 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRPGSQKFKATERVLQRLLSPLLENSSLGSDYSGCRLTMLRPIQNGTATEFLCGHWKTP
TTPSLDRKKIYWELSNQTQGITRLGAYTLDNKSLYLDAGGPNFEPFTLKFTITNMRYTAD
MGERGSSIFISTERVLQRLLSSLFEKSSLGSQDFASKLTLLRPMKEGRATLVHFTCIHRR
DPSSPVLDSEKTYCELSYLTWSITRLGPYTLEKDSLYLNGKYPHSGYAP
Download sequence
Identical sequences K7DYT0
ENSMODP00000038681 ENSMODP00000038681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]