SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038691 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038691
Domain Number 1 Region: 31-132
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000155
Family V set domains (antibody variable domain-like) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038691   Gene: ENSMODG00000027838   Transcript: ENSMODT00000041799
Sequence length 263
Comment pep:novel chromosome:BROADO5:3:440799116:440810372:-1 gene:ENSMODG00000027838 transcript:ENSMODT00000041799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYPLIDLFLLMLSGVLARGTNYTVQQEYQTLRVSEGGKVNMTCKVIWAKWEQVRVEWKK
DEGVLCQSAPIKRESSRVLCGSRDLLFWIPENIVILSLDRVTPNDSGCYECHMKKEIPLL
EETNKTTCLQVSGSGDFSKSDWINGYLGLLLWLLVACVMVGSGAVLGIKICRFLRRSRES
VHHFYGNVLYYHQKSKEAKPGKNKTLACPVERERGESIYSTSFPKPSPRLAQAPVILPVH
PRMHPATSRPIKTAYFPPTPHLS
Download sequence
Identical sequences K7DYU0
ENSMODP00000038691 ENSMODP00000038691 XP_007488972.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]