SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038703 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038703
Domain Number 1 Region: 42-99
Classification Level Classification E-value
Superfamily SEA domain 0.000000000000562
Family SEA domain 0.0057
Further Details:      
 
Domain Number 2 Region: 125-165
Classification Level Classification E-value
Superfamily SEA domain 0.000000000471
Family SEA domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038703   Gene: ENSMODG00000027787   Transcript: ENSMODT00000041811
Sequence length 180
Comment pep:novel chromosome:BROADO5:Un:80686428:80688010:1 gene:ENSMODG00000027787 transcript:ENSMODT00000041811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNLNSGFCDSNPKALCTGPSVVSYGIILHHFNDPINASFSRPLKNLTVTEVGVTCLYQSD
STGPFLDRERVYWEFSNQTGGITRLGPYTLDRDSLFLNAPIQTTTPSRISSAPSLLTNSS
ASGSFSLKSFTLNFTINNLLCTADMGRPGSQKFKATERVLQHLVRFPISSPTLLLPGTET
Download sequence
Identical sequences K7DYV2
ENSMODP00000038703 ENSMODP00000038703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]