SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038706 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038706
Domain Number 1 Region: 29-154
Classification Level Classification E-value
Superfamily Immunoglobulin 2.67e-21
Family V set domains (antibody variable domain-like) 0.0015
Further Details:      
 
Domain Number 2 Region: 148-225
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000483
Family C1 set domains (antibody constant domain-like) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038706   Gene: ENSMODG00000029594   Transcript: ENSMODT00000041814
Sequence length 303
Comment pep:novel chromosome:BROADO5:3:432538411:432558493:1 gene:ENSMODG00000029594 transcript:ENSMODT00000041814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NIDHGAHWDKWDDFGPGTEVTVLPRDETYLKESGGGLYPGNEILNLTCQTSGFQFNTSVL
GWYLWDPGCAPQWLSSLDHISTETKEERIISSREDSSSQIFLQIKGLGIGDSGNYHCTKR
VGDGDNTDKLVFGPGTDVIIEPGPRAPLTPSVFLLRSQDAVACLVSDFYPKDLNVSLASS
RASIPGQVLTVAPTARGTYSAIQIGRVDENDAVICSVQHLGKEIHMSHKSDSLKLEPSYP
DQKFKDELKMNGKRAEIMELSLNMIGTESEERNKLLLSVLSLRLLFMKTVAINVLFTMIA
LIF
Download sequence
Identical sequences K7DYV5
ENSMODP00000038706 ENSMODP00000038706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]