SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038763 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038763
Domain Number 1 Region: 72-192
Classification Level Classification E-value
Superfamily SEA domain 1.83e-28
Family SEA domain 0.00083
Further Details:      
 
Domain Number 2 Region: 451-516
Classification Level Classification E-value
Superfamily SEA domain 8.89e-16
Family SEA domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038763   Gene: ENSMODG00000029384   Transcript: ENSMODT00000041870
Sequence length 516
Comment pep:novel chromosome:BROADO5:3:462154988:462369251:-1 gene:ENSMODG00000029384 transcript:ENSMODT00000041870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSRCSTLLTKRKVTEFNRRLPSGTKNVDTSLSYGSTIAPSDDYLVFTTAYNTSGYKHQM
SFPCFTNKSWSSCYKTFTLSFTITNMFYTTKMSQKDSRTFKTAEHILQVLLKVLFRRSRL
GSQYYGCSGISLRSLKNNIATAVNVLCIFKKDSSKPVVNKKKVYWELTEQLYRRNLKHLV
IENDSLFVNGYHYKLPGIRSTKMPVTLIPDHGASEDIESLTSGLLIRESTLCAIGLSAES
KGRIRTRAGKVKTTTTCSPAVRTHSVLATITTPTTPSGTSFLERITVPASSALPETMVAP
AAWSGVISPPKTVFVAEISTPPVAGTGGGNSIGVPSNPAIHDTTASTTTFPLTNVLPAGS
TSTSATSLSSVSREDPKPMTSLDTVNSETTAMTTAKKGLALTDSTATMDNSRGSETVVLS
TSDLPTTSASPLIITNKVSTRTTMTTIADTAAGSSYSKTFTLNFTITNLFYTTKMGHRDS
GTFKAAENVIKVLLKSVFAMTNLGSHYSGCSVILLR
Download sequence
Identical sequences K7DZ12
ENSMODP00000038763 ENSMODP00000038763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]