SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038847 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038847
Domain Number 1 Region: 5-90
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000053
Family I set domains 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038847   Gene: ENSMODG00000028712   Transcript: ENSMODT00000041954
Sequence length 170
Comment pep:novel chromosome:BROADO5:1:20751647:20769860:1 gene:ENSMODG00000028712 transcript:ENSMODT00000041954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLEPNKDLKPGDMVTITCSSYGGYPEAEVIWKDGLGGVLTGNATTSHLANAEGLFDVLS
VLRVTLGANGTYNCLVRNTVLQEEASGFVIITGQVMTFPPEALWVTVGLSVCLLGLLVAL
AYVCRKKIKQSCEEEKAGAEDQDGDGEGSKTALQPLKNVDNPEDDGQEIA
Download sequence
Identical sequences K7DZ96
ENSMODP00000038847 XP_007478186.1.35504 ENSMODP00000038847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]