SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038859 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038859
Domain Number 1 Region: 32-119
Classification Level Classification E-value
Superfamily Immunoglobulin 8.84e-20
Family V set domains (antibody variable domain-like) 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038859   Gene: ENSMODG00000029758   Transcript: ENSMODT00000041965
Sequence length 125
Comment pep:novel chromosome:BROADO5:8:205181639:205182197:1 gene:ENSMODG00000029758 transcript:ENSMODT00000041965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNSWHDSAVGSGLFCYVAICLLGVGHMDTGVIQNPRYLVKGSGETVVLSCDPIKGHLYI
FWYQQLLNKELKFLTYRNKDQILDKSGMPEKRYTSEWSSLKIHPTEPGDSAHFFCASSLD
TELQI
Download sequence
Identical sequences K7DZA8
ENSMODP00000038859 ENSMODP00000038859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]