SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038866 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038866
Domain Number 1 Region: 24-125
Classification Level Classification E-value
Superfamily Immunoglobulin 4.21e-19
Family V set domains (antibody variable domain-like) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038866   Gene: ENSMODG00000027729   Transcript: ENSMODT00000041972
Sequence length 344
Comment pep:novel chromosome:BROADO5:1:351937037:351977154:-1 gene:ENSMODG00000027729 transcript:ENSMODT00000041972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLPVLFSCVLMVLFAAGPSLSAQIVTGIVGQSVTLPCDYSVQDEGGVTSMCWGRGPCPL
NKCSNEIIWTDGQKVTFQYSSRYHLKENLTQGIVSLTIYNLTEEDAGKYCCRVELSGWFN
DKKVTIRLKVEQASTVTALTTPASTRPMLTTLTSSASTRPMLTTLTSSASTHPVLTTTKD
QKSVFSTPVMDIVTTRSPATSDGKNWTQPGENDTGIATSEGYQSTNKTVILQDQLTSSNK
GIYIGVGVLAGVLLVMILLVFVLKRYFNNKKKAQSLSLTFLAHGIQEDTRTTNEGGGIHV
EDNVYAIEENVYTVEPENAYIIEEENPYVIETYHDKQQPPKVWP
Download sequence
Identical sequences K7DZB5
ENSMODP00000038866 XP_016284033.1.35504 ENSMODP00000038866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]