SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038876 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038876
Domain Number 1 Region: 284-375
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000108
Family V set domains (antibody variable domain-like) 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038876   Gene: ENSMODG00000029268   Transcript: ENSMODT00000041982
Sequence length 511
Comment pep:novel chromosome:BROADO5:7:253355352:253380057:-1 gene:ENSMODG00000029268 transcript:ENSMODT00000041982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRARTAQLASPLPAGPVWAPQCSLPPGRRLKGPGGDWQAQAGLMGGAASAGPPGSGGLG
REAVRVWRRVCVRARSPTSLLPPEAPAHSGPWKGNRKERGATACGSPVLSLRLWVPRPLR
WRACLEVRLLLSRGGLPRPPAWPGSRPPSSLHSLEYVGFSLSFSRPRGEMLRSAASGGRA
GAEGEGAGALPGLPSGSNGARFLSMTCQHPGGGPHCSQGRGRGGRRPRPGASELLPFRGL
RRPPDQVLAMRPSWGAGAAFCFVLLSWASGPSPVKMEYNLGFWPPQLSKAEGENATFVCN
VSRELMTSILNWYKEKNGSQPEKLAAYPKDKPSSPLQDRYHIAKRNGQTYEMTIVGLQLN
DSGRYFCGIINFQMPPVKESGWSELNVTERLMDSTTPTPFTTPEALEKFPRIIVVVSIIV
GAVLVLLLLCWVLFIVESRGRGGAGNSESDKDSLKVERCAASGSASAVVYGQLDFQRPEA
PPAGGAECCEQTEYAIIVFPPDKPGGSPHRK
Download sequence
Identical sequences K7DZC5
ENSMODP00000038876 ENSMODP00000038876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]