SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038933 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038933
Domain Number 1 Region: 28-138
Classification Level Classification E-value
Superfamily Immunoglobulin 1.35e-19
Family V set domains (antibody variable domain-like) 0.00068
Further Details:      
 
Domain Number 2 Region: 113-228
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000033
Family C1 set domains (antibody constant domain-like) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038933   Gene: ENSMODG00000028274   Transcript: ENSMODT00000042039
Sequence length 288
Comment pep:novel chromosome:BROADO5:5:294668473:294683835:-1 gene:ENSMODG00000028274 transcript:ENSMODT00000042039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMNPFFLLDLSFILFVLLPWSLSGEFIVLGPQETIIALVGRDVTFPCHLSPQLDAQHMD
VIWFHDQSDLVHQYRYEKDYLKQQHLDYQGWTEFLHQNISRGNVALRLHHVRPSDEGKYR
CYFARSTYNREAEFQVDVASTGSSPHLHIEGAGNKRVRVVCTSAGWYPEPEVHWRNQTEE
SLSQGTTISRKENGLFSVETSITVSADSKEIVSCVIENPLLSQKLEASVSLADALFPNVI
HQMEIWIGIIVCLIIGFLVIIIIIIVKWQKTKKEKGKELHMAARWHSG
Download sequence
Identical sequences K7DZI2
ENSMODP00000038933 ENSMODP00000038933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]