SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038939 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038939
Domain Number 1 Region: 22-148
Classification Level Classification E-value
Superfamily Immunoglobulin 5.73e-27
Family V set domains (antibody variable domain-like) 0.00086
Further Details:      
 
Domain Number 2 Region: 103-218
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000477
Family C1 set domains (antibody constant domain-like) 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038939   Gene: ENSMODG00000027695   Transcript: ENSMODT00000042046
Sequence length 284
Comment pep:novel chromosome:BROADO5:3:432949765:433229661:1 gene:ENSMODG00000027695 transcript:ENSMODT00000042046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEQWENFGPGTELTVLPLEKTLLTESGGGTYQAGKTLSLKCQTSGFQFKTSQLDWYLWTP
GHAPLWLTGLNSSSADATEGRITSSREDNKNQIFLQIEDLGLRDSGQYHCARRVGNGDDT
DKLVFGLGTRVIVEPRPAAPLSPSVFLVRDQDAVACLIRNFYPKELHVSLTSSGTLISAQ
SLSLAPTASGTYSAIHIGRVGENDAITCSVKHLGKEIHMSHQAVSDHTGPDPGIASELKL
SCPEQDITRPEQENNLLLSMLGLRLLFMKTVAINVIFTTMTLIF
Download sequence
Identical sequences K7DZI8
ENSMODP00000038939 ENSMODP00000038939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]