SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038945 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038945
Domain Number 1 Region: 45-144
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000105
Family V set domains (antibody variable domain-like) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038945   Gene: ENSMODG00000029058   Transcript: ENSMODT00000042052
Sequence length 168
Comment pep:novel chromosome:BROADO5:4:370398539:370404621:1 gene:ENSMODG00000029058 transcript:ENSMODT00000042052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSRPMDCLSEGAHRRDRPCKGLLIIASVLSCWSQPTSVLASSITAVPSPPYGMVGSNVT
LTIQGFLKPPWRYTWYRKSTDPSNEIASYVVRDGVQTPATNREKVFANGSLLIPNLTFRD
NDDYIVQVFYSESEVTTARAHLQVFSPRSRMITAGILIGVVAKVALIG
Download sequence
Identical sequences K7DZJ4
ENSMODP00000038945 ENSMODP00000038945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]