SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039003 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039003
Domain Number 1 Region: 1520-1608
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000872
Family Fibronectin type III 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039003   Gene: ENSMODG00000029793   Transcript: ENSMODT00000042112
Sequence length 1658
Comment pep:novel chromosome:BROADO5:5:222927457:223097417:-1 gene:ENSMODG00000029793 transcript:ENSMODT00000042112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDASAQRGKERKFCYHVKAPAEEKIDSMNLNVKIDTSWVFQDIEDADDMLGGLSEEGAKS
SEDDAGNLRKQLETSEQRLRTAVEKHVRSESRLRNRIEELELSEQKLLQRVGQLNAQVYQ
EENAFLQAKEKLEEIQEELTDLVEETERARKAQREKLQHFQDQLHRKDEELQRLLATFER
YKQNQRRQMDVVKEQEGFLKGQVLRLEEEAQHLRAATASLMAELEGEGSQGLDSQSQVPL
EKSGSSPWYVGEDMAELRAFLEAGELQARKHLASLQQSLMALLAKEESNNQEKEEILRQL
QEHRDTVLHLLVNKLEDFQSPRSELPREGLKEQSTSLQDEPGAKEAQDMNRTKDAEVLFH
SESQAQSKPSFVPDELLPLRWEVALDPSRNKACQTSFVIENAKGSGGVVAALQAEQESDL
GSFGGMKGSQALMSTVDNLNELLEEIKISYGAQSSSGVSTSDPKRVLFFFCGPSSGNLND
DHLFFDQLIFSRAMPEPQNKESFPFLEKSMIPLLMPMVIPSAPGSLAVLEDSFQEELPQS
HVSHELQSVHVSQIPEEPSWNPKETQTIIDEPQSLLKSDISIKDSSMPEETFDQSVGATE
LELEEDKQEKWFKNQDIVPQNGINKKEHLDLDLSNASILDHGVKCPESCENAILVTDIEN
SQYLIKINELEKEVEKHFQGIVALEEENESYRQKIKQLKEENWRYSHHLKSLDVEENVGT
PTASADADGGTAVDSSEILEGRDEKDVSESVKLKKGKDIRTICAPEMKNETHSTNLPDVN
EVILNSQLATWTDDLNRFPLKREAQENTKARFFQLISDLHKERNQVFLKMTTLHRAQEIC
NNKTYALEEEKEINLKRITKLEKDKNILIENLTQLRNELDLYLHLVSDLEECNGKNYEKI
SDLEEENMILKKKVHTIQKAMAKNIREAREMTEQVTQENQELKALIADLGNGYKDLIEDL
VPGIQDVMQSLKEENEQLLHKIDVREEKAMGETKDIERITKDSKQNEKLKEQIQKLLAKA
NMVEQGIQVTESSDRPTRDERSHLEEASFFAKGQKQLPMYGEKYQLHMHNTRMSSFLVRK
NPEISSDTQEPTNECEQKRADLKKNKKGKCSSEFHNQAHNSLASSSQLQDTKTMIPKRES
KSNNKLLHHQILTLKSQLRDQAVLHSELQTSQNETRYLQGQLTEKIEELKRRKNEVNSAV
TPLRAKVASLVQKCRDRNNLVAQLLQELHRHGIENLKLSETARALVDDVAVATYASTFMS
SEPREPCHQSDAMSEDIALGKDQTCLLSPDMANPLGYFSSDTSPAADSDPLLWKTHTGSP
NLPSGVMNNPRTCQTGMDVGVGLISESIQQETQEICSLSTPPTNDLPLPSKVMSPERILA
LHWELSHSRYNNYQNLASPSESALSGSMTQPSLVEHTRTCFSEPLAGSSFEEHQGQEQGC
KRGYQPSSETKNQHSGTEHWGSSPRNTIMNNTWTSGDQPDGSTSKTTAKSHLSNGLSASN
KGLIPLGKDSDVLERARSLTIKQEAPAPVGSLSIIKTVGKRCLMIGWERPLVDELGCSNG
TFVEGYRIYIDGKFHKYLVSSACTKTLLENLDLSVPFSISVQTEGTGGLVSEKVHIVFNH
WANKGTSSSGSSISPDKQDRGSSFPEERRRHINKAHKP
Download sequence
Identical sequences K7DZQ2
ENSMODP00000039003 ENSMODP00000039003 XP_007496815.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]