SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039069 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039069
Domain Number 1 Region: 68-161
Classification Level Classification E-value
Superfamily Immunoglobulin 2.42e-21
Family I set domains 0.041
Further Details:      
 
Domain Number 2 Region: 2-65
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000228
Family I set domains 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039069   Gene: ENSMODG00000028197   Transcript: ENSMODT00000043431
Sequence length 177
Comment pep:novel chromosome:BROADO5:Un:95251801:95252851:1 gene:ENSMODG00000028197 transcript:ENSMODT00000043431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFMWLKAGTPEPLGRALQQSQRWADFTLPSVKVQDAGSFRCVYYEKTVQPRASEPSEPLH
VCVTDSLTRPSLTVEPSSSVSLGEKVTLWCQSASCGTRFTLYKDGEDKPVQIIDSPQDKA
GFLIAQVTHNDTGTYYCLHHTGEDIPTPALYSDHLELSVSGEQELLLHKASEWGDGG
Download sequence
Identical sequences K7DZW8
ENSMODP00000039069 ENSMODP00000039069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]