SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039121 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039121
Domain Number 1 Region: 16-94
Classification Level Classification E-value
Superfamily Immunoglobulin 5.42e-17
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 110-180
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000388
Family I set domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039121   Gene: ENSMODG00000028636   Transcript: ENSMODT00000042230
Sequence length 232
Comment pep:novel chromosome:BROADO5:2:103068472:103082004:1 gene:ENSMODG00000028636 transcript:ENSMODT00000042230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYENLLSPSKINNTGFVIENGTAILTCNTEGYDLPDIWWYYKNKRMVLNDRMTLSNFDQT
LTITPAKREDSGAYRCEIWDPFLVYRSPLFNLVVCYGPEKIKIFPNSVNGQIEVTLKENL
TLGCQATSEPPAQYTWQINGSSIAVNSGNNYTIYRASWDHAGTYTCIAINDVVNATISKN
IRVRVIEKEAHTLSGGAIIGLVIGFLAVVVLIGALVYFLFIRTSSGPQYFYQ
Download sequence
Identical sequences K7E020
ENSMODP00000039121 ENSMODP00000039121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]