SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039140 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000039140
Domain Number - Region: 119-174
Classification Level Classification E-value
Superfamily STIV B116-like 0.0562
Family STIV B116-like 0.0049
Further Details:      
 
Domain Number - Region: 176-274
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.0578
Family RNA-dependent RNA-polymerase 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039140   Gene: ENSMODG00000029750   Transcript: ENSMODT00000042249
Sequence length 295
Comment pep:novel chromosome:BROADO5:3:321485371:321486432:1 gene:ENSMODG00000029750 transcript:ENSMODT00000042249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAAFSDHKAIKIMISNGTWKTKSKTNWKLNNMILQNRLVKEEIIETINNFIKENDNGET
SFQTFWDAAKAVIRGKFISLNAYINKQGRAEINQLEMQMKKLESDQIKNPQQKTKLEILK
IKGEINKIESDRTIDLINETRSWYFEKTNKIDKVLVNLVKKRKEEKQIHSIKDEKGDSTS
NEEEIKAIIRNYFAQLYGNKYTNLGEMDEYIQKYKLPRLTEEEIEFLNNPISEIEIQQAI
KELPKKKSPGPDGFTCEFYQTFREQLIPILYKLFDIISKEGVLPNSFYDTNMVLI
Download sequence
Identical sequences K7E039
ENSMODP00000039140 ENSMODP00000039140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]