SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039153 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039153
Domain Number 1 Region: 108-234
Classification Level Classification E-value
Superfamily Immunoglobulin 6.9e-19
Family C1 set domains (antibody constant domain-like) 0.011
Further Details:      
 
Domain Number 2 Region: 32-144
Classification Level Classification E-value
Superfamily Immunoglobulin 1.54e-17
Family V set domains (antibody variable domain-like) 0.012
Further Details:      
 
Domain Number 3 Region: 243-330
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000851
Family C1 set domains (antibody constant domain-like) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039153   Gene: ENSMODG00000019562   Transcript: ENSMODT00000042263
Sequence length 404
Comment pep:novel chromosome:BROADO5:1:404401017:404436978:-1 gene:ENSMODG00000019562 transcript:ENSMODT00000042263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPIYLHDSTLPSFFLTLLLGLSGTQGQKEPQLLQPKDLVTVTVGEVVTLNCTVTDAAV
PGPVKWFKGTGLQRKEIYNFKGGSYPRIKAVVPSSNTDFSISISNITPEDTGTYYCVKFK
RGNPDTEFKSGGSTKLIVRVKPSIPLVSSLSGRTNPNKKVNFTCMAMRFFPRDITVKWFK
NGNELSALQTNILPIGDSITYNVTSDVQVLLTSKDILSQVTCEVMHSTLQNPLRGTKNLS
HYLRVPPEVTVSTQSAPLNLTKVTCHVKRFYPPSVKIIWQENGYLSGGEESSLLTENTDG
TYTQESSMLVNTFVQKEERVLICQVAHDLGPLVSASETLRASYYLVVGSGLSQATRYFFI
VSTLGMKILFLLSLSTIYILRKHRIAQLKEPPVPSELLSLQTGV
Download sequence
Identical sequences K7E052
ENSMODP00000039153 ENSMODP00000039153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]