SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039156 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039156
Domain Number 1 Region: 482-673
Classification Level Classification E-value
Superfamily Fibronectin type III 1.18e-30
Family Fibronectin type III 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039156   Gene: ENSMODG00000027376   Transcript: ENSMODT00000042266
Sequence length 700
Comment pep:novel chromosome:BROADO5:8:214472564:214482972:-1 gene:ENSMODG00000027376 transcript:ENSMODT00000042266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVIFWRGEDSENPCITLWDRETLKSNVTTEEQCKTEFDILTSDSFDAKTSALNIHGELKA
SVLGGMVDIGGSAKYLWDTKTFSQQARVTLKYSMTTQYCHLTMNHLGYQNLSFPDVFDKG
TATHVVTAVLYGAQAFFVFDQQVSTSENVKDIEGSLMVQVKKILKVTGNIEGEMKMNSEK
KSAKEFRCRFYGDFVLENNPVTYEDAVKVYASLPKLLRGHGVPLLVWLYPLEKLSSKAAK
LVQGISISLVCDAQYTLERLSECDKKCNDMLEAPGLFSVTQEKLRLFQELNKQHRQILQR
KIAKVLPLIRGGRTTEYNLASILTMESQSPFSSRRLSEFLDQKFLEIKVINSFLTLLKEV
RVIADQSELQDVVLGSPSQFVLVFALTSLQEEPYLADWKLWLWNPVSFILKCKQKTYSSW
VEDKEIRRKAIHLAESFSKFAKNNHSTGKTQFFVSSIPDQENKGVSIHLYERGLQISSNF
ELPVKPPPPQIGGVTHDYVELILTPASEKKEGIIGYRVEYQVVGEEDWTIIAVSGAPEVF
KVTGLEPSTQYLFRFAQVCELGHGENSDVSSATKVPPSTSPPGKPKAVVVGSQFITLQWQ
GPSVDGAGVKIKEYRIEYREEPESVGEEEEEGEWHEYRTGNDENCYTIKGLMPQTVYCFQ
VSAVYDGGWTSESSDKSDPVKTRTSAMGKKHNMIRGTFSN
Download sequence
Identical sequences K7E055
ENSMODP00000039156 ENSMODP00000039156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]