SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039162 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039162
Domain Number 1 Region: 256-381
Classification Level Classification E-value
Superfamily SEA domain 1.18e-32
Family SEA domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039162   Gene: ENSMODG00000028995   Transcript: ENSMODT00000042272
Sequence length 630
Comment pep:novel chromosome:BROADO5:Un:52194283:52215102:-1 gene:ENSMODG00000028995 transcript:ENSMODT00000042272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSFILLVPVTLIPDHGASEDIESLTSGLLIRESTLCAIGLSAESKGRIRTRAGKVKTTT
TCSPAVRTHSVLATITTPTTPSGTSCLERITVPASSALPETMVAPAAWSGVISPSKTVFV
AEISTPPVAGTGGGNSIGVPSNPAIHDTTASTTFFPLTNVLPAGSTSTSATSLSSVSRED
PKPMTSLDTVISETTAMTTAKKGLALTDSTATMDNSRGSETVVLSTSDLPTTSASPLIIT
NKVSTRTTMTTIADTAAGSSYSKIFTLNFTITNLFYTTKMGHRDSGTFKAAENVIKVLLK
SVFAMTNLGSHYSGCSVILLRPLKNGTATGVDVLCTCQEDSSNPVLDKEKVYWELSEQIY
RRNLRHLLIERDSLFVDGYNHKIPGIRSTNRPSAESKGRIMTTAGEPETIMTTTSSPAVR
THSVLATTVSTTASDIDLEKITLPASSALPETMVAPAAWSGVEMSPSETMFIAEGSTLPG
TGTEGGSPIGVPSHPATHDTTASTTAFPWTNVLPAGSTSTSATSLSSVSREDPKPMTSLD
TSASETTAMATAMEEPALTESTVTMNISRGAEAVVLSTSDLPTSSAVPLIPTDKVSTRTT
MTTIADTGKNSSFIIFPAGTWGYNLVKYRE
Download sequence
Identical sequences K7E061
ENSMODP00000039162 ENSMODP00000039162 XP_007506677.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]