SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039184 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039184
Domain Number 1 Region: 1-106
Classification Level Classification E-value
Superfamily SEA domain 5.49e-31
Family SEA domain 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039184   Gene: ENSMODG00000028580   Transcript: ENSMODT00000042294
Sequence length 107
Comment pep:novel chromosome:BROADO5:Un:92651011:92653343:-1 gene:ENSMODG00000028580 transcript:ENSMODT00000042294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFYTTTMSQRRSNTFRATEFILQHLFKVLFERSSLGSQYSGCSVTLLRSMNNGKATGVEV
ICSYQEVLSIPVLDKKKIYQELSLQTNGITKLGSYILDNESLYVDGE
Download sequence
Identical sequences K7E083
ENSMODP00000039184 XP_007506436.1.35504 ENSMODP00000039184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]