SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039190 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039190
Domain Number 1 Region: 25-109
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000693
Family V set domains (antibody variable domain-like) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039190   Gene: ENSMODG00000028304   Transcript: ENSMODT00000042300
Sequence length 230
Comment pep:novel chromosome:BROADO5:1:451074850:451103034:-1 gene:ENSMODG00000028304 transcript:ENSMODT00000042300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSLSFWALLTLIDSWAWVGTQAQEPKVIVQSVSSVRATIGSSVTLPCTVISEVPGPVKW
YKGRIYGKIIYSDKEPSPRGQRVKNTNSILDILISNITRQDEGAYLCVKFKKGNNGDEVV
SIVSNTTLYIVDSQISSGVIVAATAGSVCLSLVFLALFCYFKRKTGQSPCSARFVCSRPE
ASKTNQPQKEPKGNKEIVYADLQPIEKSRQSMSPARVKGFHSEYATIQLQ
Download sequence
Identical sequences K7E089
ENSMODP00000039190 ENSMODP00000039190 XP_007475013.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]