SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039211 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039211
Domain Number 1 Region: 2-58
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000476
Family SH3-domain 0.00031
Further Details:      
 
Domain Number 2 Region: 128-178
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000358
Family I set domains 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039211   Gene: ENSMODG00000027685   Transcript: ENSMODT00000042321
Sequence length 187
Comment pep:novel chromosome:BROADO5:Un:83526686:83531445:1 gene:ENSMODG00000027685 transcript:ENSMODT00000042321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVTHDYTAVKEDEINVYQGEVVQILASNQQNMFLVFRAATDQCPAAEGWIPGYVLGHTS
AVIIENPDGTMKKSTSWHTALRLRKKSEKKDKDGKREGKLENGYRKSREGLTNKVSVKLL
NPNYIYDVPPEFIIPLSEVTCETGETIVLRCRVCGRPKASIIWKGPEHNTLSSNGRYSSH
TGVPKHL
Download sequence
Identical sequences K7E0B0
ENSMODP00000039211 XP_007505682.1.35504 ENSMODP00000039211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]