SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039270 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039270
Domain Number 1 Region: 47-169
Classification Level Classification E-value
Superfamily SEA domain 1.57e-32
Family SEA domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039270   Gene: ENSMODG00000029748   Transcript: ENSMODT00000042380
Sequence length 193
Comment pep:novel chromosome:BROADO5:Un:89115098:89118562:-1 gene:ENSMODG00000029748 transcript:ENSMODT00000042380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRYMFSFIPLESEIAVGPVTHIPDHGAPGDMTSVTSSLYESTVGAIAAGSSYSKTFTLNF
TITNMFYTPDMGERGSNTFKAAENVLQVLLKFLFGMSNLGSHYSACSVNLLRSLKNGTAT
GVDVLCTFQEDSSNPVLNKEKVYWELTEQIQRRRLKHVLIERDSLFVDGKYLDLGNVLLF
LWVVPVPEYNPSA
Download sequence
Identical sequences K7E0G9
ENSMODP00000039270 ENSMODP00000039270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]