SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039285 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039285
Domain Number 1 Region: 21-113
Classification Level Classification E-value
Superfamily Immunoglobulin 4.94e-22
Family V set domains (antibody variable domain-like) 0.0000641
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039285   Gene: ENSMODG00000029010   Transcript: ENSMODT00000042395
Sequence length 115
Comment pep:novel chromosome:BROADO5:1:170946366:170947213:1 gene:ENSMODG00000029010 transcript:ENSMODT00000042395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MICGSIPALLMFFILRESGAQSVTQPEDQITVSEGDPLEVKCTYSYGGSLYLFWYIQYPN
QGLQLLLKYVSGNPLVKGINGFEAELNKTQSSFHLKKLSAQRSDSAEYFCALDTQ
Download sequence
Identical sequences K7E0I4
ENSMODP00000039285 ENSMODP00000039285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]