SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039336 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039336
Domain Number 1 Region: 124-546
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.22e-118
Family Reverse transcriptase 0.000000041
Further Details:      
 
Domain Number 2 Region: 603-750
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.67e-30
Family Ribonuclease H 0.0024
Further Details:      
 
Domain Number 3 Region: 2-76
Classification Level Classification E-value
Superfamily Acid proteases 0.00000176
Family Retroviral protease (retropepsin) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039336   Gene: ENSMODG00000029647   Transcript: ENSMODT00000042446
Sequence length 793
Comment pep:novel chromosome:BROADO5:5:294299604:294301982:-1 gene:ENSMODG00000029647 transcript:ENSMODT00000042446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVLNPTAFPSPLPRSDQKISIVGITNHVQSVYLSQPLPFILGEVKDMHSFLLSSDAPLH
LLGRDFLDKDKATIEFSPGKEIRLSLSPSDAPPTFQILTAPIIAYDLPQLEEVPSSLWAT
DSSDIGRILSAPPIQVQLDPSKPLPRVPQYPLSREATEGIRPLIDSYLEAGILIKCTSPC
NSPILGVRKPGGRGWRLVQDLRAVNACVIPRAPVVPNPHNLLNQIPHSAKIFTVVDLCSA
YFSVPLHADSQFLFAFTWEGIQLCWTVLPQGYTESATYFSQVLKADLAGLKFPFGSTLLQ
YVDDLLLCSPDAQSSREDSIVLLKSLAQKGHKVSKEKMQFVSSQVKFLGHLISAEGRSLD
PARVAAILNFPRPKTKRQLRGFMGLAGYCRLWVPSFSLVAKPLFDLLKASSPEPLIWNEA
AKIAFMDLKSALSSSPALGRPNYSLPFHLFLLERNGISLGVLSQKHGDHFRPLGYYSKSL
DSVARGLPSCLRAVVAASDLLELVEEVTLESPLTLHVPHAIEVLLNSHHTQHFSTSRLAK
LEASLLAKSNITISRCKTLNPATFLPDIEESDRDCTEGHDCVNIVDSVLSPREDLQENEL
ENPDFSWYTDGSCLRNESGILVARYAITTTAEVIEAGHLPSAFSAQQAELEAVTRACELA
KGKRVNIYTDSRYAFGVAHDFGMLWQHRGYLTSSGTPIKNGAQVRRLLEALLLPKAIAII
KIPGHSRENSPHAKGNALADQYAKEAARQVPTTIGLALSDKEEPIFENKLTQAEIVSAQE
VMSRTIQEKLEKE
Download sequence
Identical sequences K7E0N5
ENSMODP00000039336 ENSMODP00000039336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]