SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039338 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039338
Domain Number 1 Region: 40-128
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000129
Family Fibronectin type III 0.0035
Further Details:      
 
Domain Number 2 Region: 142-226
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000196
Family Fibronectin type III 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039338   Gene: ENSMODG00000027528   Transcript: ENSMODT00000042448
Sequence length 226
Comment pep:novel chromosome:BROADO5:7:49447390:49485201:-1 gene:ENSMODG00000027528 transcript:ENSMODT00000042448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCHLHGFHPWCHGAEFQINGIAGKSFSKTYHLPQRGKEGTTKEVITCHVHEAKFMDCNWT
VRKIPRDIHYRFFYSQAGRKVVDKECPQYKTDSKGRNVGCHFDNISGFNYFLEHHFLVNG
TSNGTEIQCNDAYISLNDIEILTPPNININCRHFSCYMHWNMPKSIQLSENSFQLEIQKN
SEKSFRLITNMTKERNFVFKKVAGKYTVKIRTKNIVGGNWSEWSKP
Download sequence
Identical sequences K7E0N7
ENSMODP00000039338 ENSMODP00000039338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]