SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039416 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039416
Domain Number 1 Region: 113-211
Classification Level Classification E-value
Superfamily Immunoglobulin 1.88e-19
Family I set domains 0.0097
Further Details:      
 
Domain Number 2 Region: 13-111
Classification Level Classification E-value
Superfamily Immunoglobulin 1.08e-18
Family I set domains 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039416   Gene: ENSMODG00000029754   Transcript: ENSMODT00000042524
Sequence length 436
Comment pep:novel chromosome:BROADO5:4:406521968:406527964:1 gene:ENSMODG00000029754 transcript:ENSMODT00000042524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSQALELTVLGHLPRPVLWVQPGLVPVPGANVTLWCSRPQLASLEEVSFTLWKAGTPRPV
RYQLSAERWTDFHFPSVSPEDTGSYRCSYSERKGSGRASELSGALELVVPGSLPKPSLLV
FPGLVVEPGIHVTLQCQQPPESPLWGVTFALLKVGIPQPLQSQSPAGTSADFLLPSVRVQ
DAGNYSCIYYGRSIPNQVSEPSEVLEIWVPGGTRVALCKEGDEKVLPSKDTTEDGPQLIL
SYVTSKHSGICNCSYQPGKNGNLWTQPCELKVRASEPSYTFIITLSSVAFLFLLLCLLLL
EFLCHAPIATGALQGDSSRRFSSGKSHDAHWGCPFRSGVLQTKHILSDLDLKFFCHRDFM
SKTNDFAHLFTLWKRDPEAVELTFQALRTGKIGLCIQGFLLNQVIPVGPKSDILTPIRSI
ILSEVLSGPPRRQLVL
Download sequence
Identical sequences K7E0W5
ENSMODP00000039416 ENSMODP00000039416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]