SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039426 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039426
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily SEA domain 1.11e-31
Family SEA domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039426   Gene: ENSMODG00000029030   Transcript: ENSMODT00000042533
Sequence length 113
Comment pep:novel chromosome:BROADO5:Un:92622331:92627582:1 gene:ENSMODG00000029030 transcript:ENSMODT00000042533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRPGSQKFKATERVLEHLLSHLLENSSLGSDYSGCRLTMLRPVQNGTATKFLCGHWKTP
TTPSLDRKKIYWELSNQTQGITRLGAYTLDNKSLYLDGYSYQMNLSSSTSEIS
Download sequence
Identical sequences K7E0X5
ENSMODP00000039426 ENSMODP00000039426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]