SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039437 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039437
Domain Number 1 Region: 63-153
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000576
Family Spectrin repeat 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039437   Gene: ENSMODG00000027323   Transcript: ENSMODT00000042543
Sequence length 181
Comment pep:novel chromosome:BROADO5:Un:72427504:72440392:1 gene:ENSMODG00000027323 transcript:ENSMODT00000042543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQANADQVERDILETQKRLKLDRTNSEQNQALQYQEETGRDLKEAEMLLKDLFLDMDKAK
RLKHPQAAEIEKDIKQLHERVTQECAEYRQLYEKIVLPSDLAPKVDWARVLEQKQKQICE
GQYGSGMSELEQQIAEHNILQREIEAYGQQLRCFNGPVGEPLFPEPSLQLSSSALRVWLH
L
Download sequence
Identical sequences K7E0Y6
ENSMODP00000039437 ENSMODP00000039437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]