SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039441 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039441
Domain Number 1 Region: 28-132
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000848
Family V set domains (antibody variable domain-like) 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039441   Gene: ENSMODG00000028475   Transcript: ENSMODT00000042547
Sequence length 294
Comment pep:novel chromosome:BROADO5:2:283641427:283663503:-1 gene:ENSMODG00000028475 transcript:ENSMODT00000042547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVREAPLLLFLLFLEISGSKKAETIEEYTKEEGQTLNVNCSYRPWNLKREFNVWCKLQEN
GKDCNKYVSIRKNSVFTKEGKFFFNMLDEPKSGKIIIIMSGLRVKDSGHYLCVVIEQNAA
TVLKKIHLEVTPVQSTTKGVSNTSKVHQTTVTTYRKKRDPGNPSLSEKEKFIILGMALPF
LLLLGVLIIGIVYIKKLHQKVRKGDNFQYMCDNSEYNMQKPRDPSMEMDNGEDPRDIHYA
SLNYIGPRESMHTNILKGYNSKTMQIPHESVEYASILRTGFQHPKSNAPVGREC
Download sequence
Identical sequences K7E0Z0
ENSMODP00000039441 XP_007483913.1.35504 ENSMODP00000039441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]