SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039477 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039477
Domain Number 1 Region: 56-157
Classification Level Classification E-value
Superfamily Virus ectodomain 8.89e-29
Family Virus ectodomain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039477   Gene: ENSMODG00000027447   Transcript: ENSMODT00000042583
Sequence length 176
Comment pep:novel chromosome:BROADO5:8:31995241:32002759:-1 gene:ENSMODG00000027447 transcript:ENSMODT00000042583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKRRVEAGQTALRQGKYRMIPICLILFLSICPSSASPESPHLLGHQTRAPFSTLAIILG
IGGLAAGIATGTSPPPLAQHLAALQSAMTTDLEDLEKAISALEKSLTSLSKVVLQNQRGL
DLLFLKEGGLCAALKEECCFYADHTGVVRESMAKLRESLLLRKKEAEAQEGGTTIF
Download sequence
Identical sequences K7E126
ENSMODP00000039477 ENSMODP00000039477 XP_007503024.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]