SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039486 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039486
Domain Number 1 Region: 97-178
Classification Level Classification E-value
Superfamily Immunoglobulin 2.72e-16
Family I set domains 0.0083
Further Details:      
 
Domain Number 2 Region: 15-105
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000109
Family I set domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039486   Gene: ENSMODG00000028353   Transcript: ENSMODT00000042592
Sequence length 207
Comment pep:novel chromosome:BROADO5:Un:73558915:73560041:1 gene:ENSMODG00000028353 transcript:ENSMODT00000042592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSILCTAPLSKPTILTSNNTAVETKDFSLTCNATGQIHAYKWFINGVAPAGLRIQLSPDR
RTLTLRSLTRSDNKGPYVCEIENPFYRNRSDPFTLDVAYGPDITTIVHSPDEYRPGANIT
LSCVADSNPAAQFTWLHNGQSVSNSATFSIIASLSDAGTYTCTASNSFTGLTRTATKNII
IYGEYLDWAPNFVWGSLFPWHDRNRQK
Download sequence
Identical sequences K7E135
ENSMODP00000039486 ENSMODP00000039486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]