SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039522 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039522
Domain Number 1 Region: 21-135
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000972
Family V set domains (antibody variable domain-like) 0.032
Further Details:      
 
Domain Number 2 Region: 143-223
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000399
Family C2 set domains 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039522   Gene: ENSMODG00000029138   Transcript: ENSMODT00000042628
Sequence length 304
Comment pep:novel chromosome:BROADO5:4:16608511:16634872:-1 gene:ENSMODG00000029138 transcript:ENSMODT00000042628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLKRTECLLLFLAALRAVIMKEIHGMVGDNVELSCISPIQRHFDLQNIHVYWQTTKTPP
ESVKSYIPGENSSQYDDSKYKNRASLTPEKMERGDFSLLLSNITTKDEQEFVCIVLNKSS
FGILLQSEVTLRVAANFSVPVVAQETNNTEVTFTCTSHNGFPEPKVYWVNKTDNSLLNHT
LQTVTKNEKGLFSVYSVLTIEWTPNISIECCIENVNLQQNLTVWKGFLPSLGGNTGQLKF
TTIPNEPRPPETTSNTALFIIIGILFVVLVAAIISRQLCKKRHHYGHYTGPQRNTEMAEA
IDYS
Download sequence
Identical sequences K7E171
XP_007493357.1.35504 ENSMODP00000039522 ENSMODP00000039522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]