SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039534 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039534
Domain Number 1 Region: 336-427
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000014
Family I set domains 0.0033
Further Details:      
 
Domain Number 2 Region: 419-517
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000199
Family I set domains 0.033
Further Details:      
 
Domain Number 3 Region: 228-330
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000115
Family V set domains (antibody variable domain-like) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039534   Gene: ENSMODG00000027776   Transcript: ENSMODT00000042640
Sequence length 557
Comment pep:novel chromosome:BROADO5:4:369209273:369301241:1 gene:ENSMODG00000027776 transcript:ENSMODT00000042640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEGLLVSQTQKRKKNRKQSQSPSCSQSQSQIWSHSPSASPSPFPPRTHNRTAHSSNHHS
SSYTQPHTHSHYSHNSNHHHSNSCLNRRKATGLAKRKAKKGLSPNRRKKRADRRAPALKR
KIPVLWSRGSSLHRDRDRLWGSHTTFSLESSRDSSRETPTDETPCWAGEQRFLGRREAVT
PGGQCRPMERPSKASQSRGSTWKGLLIITATILSCWIQPMSAQDLMVELKPAQGKVGDTV
TLNILDYSGSALMYSWYYKPSTRNSKEKLILRYSPGSTSQTPNNTRQKVHPNGSLIIPNL
VLSDSGDYKVQIKDSSSKILRARAPLKVYENTLIKPTITIQSTGHIVENDSAVMSCNSKH
KDLSQIRWYFQNKKLILNKRMSLPLNNQTLIIIPVMREDNGAYKCEVWNPFSASMSDLFK
LTVCYGPEKITILPKHVHGQIEVLLNKKLILECQASSEPPAQYTWQVNGSSRAGNSGNIY
AISKLSWGHSGTYTCMAMNSVINTAISKNIRVRVYEPSGGSIRGGDVVAGIVIGVLAGVA
LIVALIYYMVIGESSGE
Download sequence
Identical sequences K7E183
ENSMODP00000039534 ENSMODP00000039534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]